Disorder predictions for all reviewed UniProt proteins with "membrane" subcellular localization
收藏资源简介:
IDRs in membrane proteins About The writeup below walks through how to answer the question "what fraction of membrane proteins have IDRs". The tl/dr: on average 55% of membrane proteins [as defined here] have IDRs. Data This directory (WITH the associated sequences), which are not included on GitHub, are deposited on Zenodo. Steps Install software Install metapredict pip install metapredict Done. Find the data Using the "Advanced Search", I downloaded all reviewed proteins on UniProt tagged as having a "membrane" subcellular localization. There are, of course, much more detailed ways one could get these data (e.g., requiring transmembrane helices, integral membrane protein filtering etc, etc), but I figured for purposes here, I'd just do this... Download the data From this, I downloaded all the FASTA sequences. This triggers the following file to be downloaded: uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_09.fasta Preprocessing the data Next I wanted to fix any sequences with non-standard amino acids by converting those residues to "standard" amino acids. I did this using pfasta, a commandline tool that's part of protfasta which comes with metapredict. Did this simply with pfasta --invalid-sequence convert-all -o membrane_proteins.fasta uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_08.fasta The --invalid-sequence flag tells pfasta what to with an invalid sequence, and -o tells it what the ouput file should be called. Running this (~5 seconds) generates the following output: ........................ pfasta version 0.1.13+0.gc1786bd.dirty Please report bugs to: https://github.com/holehouse-lab/protfasta ........................ [INFO]: Reading in the file uniprotkb_cc_scl_term_SL_0162_AND_revie_2024_11_08.fasta [INFO]: Read in file with 1004330 lines [INFO]: Parsed file to recover 117691 sequences [INFO]: Converted 697 sequences to valid sequences [INFO]: Writing new sequence file [membrane_proteins.fasta]... Predicting all IDRs Run one of metapredict's command-line utilities to predict all IDRs in these proteins. metapredict-predict-idrs membrane_proteins.fasta -o membrane_protein_idrs.fasta This takes ~20 seconds on my desktop with an A4500 GPU or ~5 min with my Macbook Pro. We're then left with a file called membrane_protein_idrs.fasta. This is a FASTA file that the header format: > IDR_START= IDR_END= e.g. >sp|B4R1D8|HH_DROSI Protein hedgehog OS=Drosophila simulans OX=7240 GN=hh PE=3 SV=1 IDR_START=0 IDR_END=94 MDNHSSVPWASAASVTCLSLDAKCHSSSSSCSSKSTASSISASPETQTMRHIAHTQRCLS RLTSLVALLLIVLPMMFSPAHSCGPGRGLGRHRA Hacky way to get number of proteins with IDRs Get the number of unique proteins in the main file: cat membrane_proteins.fasta | grep ">" | awk -F "|" {' print $2 '} | sort | uniq |wc Which returns 117691 117691 829609 So we have 117,691 unique proteins (NB: we could also just have gotten this without the awk -F "|" {' print $2 '} | sort | uniq part BUT we do need that for the number of unique proteins with IDRs so good to be consistent. cat membrane_protein_idrs.fasta | grep ">" | awk -F "|" {' print $2 '} | sort | uniq |wc Which returns 64971 64971 458829 So on average 55% of membrane proteins [as defined here] have IDRs. Bonus! In addition we can predict all disorder scores rather than discrete IDRs using metapredict-predict-disorder membrane_proteins.fasta -o membrane_protein_disorder_scores.csv This takes ~5 min on my Macbook Pro. The data for these are included here for completeness/convenience.




