Contribution of anti-MPER antibodies to the plasma's cross-neutralizing activities.
收藏资源简介:
aPatient ID. bYears post infection. cBreadth: the percentage of HIV-1 isolates neutralized by each plasma, out of the total number of isolates the plasma was tested against. dThe neutralizing activities of plasmas collected at the indicated time points following infection were evaluated against the HIV-1 viruses JRFL and TRO.11 in the absence or presence of the MPER peptide (NEQELLELDKWASLWNWFDITNWLWYIRKKK). The Log10 decrease in IC50 neutralization titers in the presence of the MPER peptide is indicated. eNo affect in the neutralizing activities of plasmas was recorded in the presence of the MPER peptide. fExperiment not performed. gThe IC50 neutralizing titers of plasma samples collected from subject AC131, against four HIV2/HIV-1 MPER chimeric viruses are indicated. The MPER amino acid sequences of the parental strains and the chimeras are as follows: 7312A HIV-2 (QIQQEKNMYELQKLNSWDVFGNWFDLASWVKYIQYGVYIV), YU-2 MPER (NEQELLALDKWASLWNWFDITKWLWYIKI), 7312A-C1 (QIQQEKNMYELLALDKWASLWNWFDITKWLWYIKYGVYIV), 7312A-C3 (QIQQEKNMYELLALDKWASLWNWFDLASWVKYIQYGVYIV), 7312A-C4 (QIQQEKNMYELQKLNSWDVFGNWFDITKWLWYIKYGVYIV), 7312A-C8 (QIQQEKNMYELQKLNSWASLWNWFDITKWLWYIKYGVYIV). For each chimeric virus, we indicate whether it expresses the 2F5, 4E10, Z13 epitopes, or the entire HIV-1 MPER The core epitopes of 2F5 (ALDKWA), Z13 (WASLWNWFDIT) and 4E10 (NWFDIT) are underlined.



